APOA1 monoclonal antibody (M01), clone S1, Mouse, Monoclonal

Catalog Number: ABN-H00000335-M01
Article Name: APOA1 monoclonal antibody (M01), clone S1, Mouse, Monoclonal
Biozol Catalog Number: ABN-H00000335-M01
Supplier Catalog Number: H00000335-M01
Alternative Catalog Number: ABN-H00000335-M01-50
Manufacturer: Abnova
Host: Mouse
Category: Antikörper
Application: ELISA, IP, WB
Species Reactivity: Human
Immunogen: APOA1 (AAH05380, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Names: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full-length recombinant APOA1.
Clonality: Monoclonal
UniProt: 335
Buffer: In 1x PBS, pH 7.4
Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLS
Target: APOA1