BMP5 monoclonal antibody (M51), clone 1G6, Clone: [1G6], Mouse, Monoclonal

Catalog Number: ABN-H00000653-M51
Article Name: BMP5 monoclonal antibody (M51), clone 1G6, Clone: [1G6], Mouse, Monoclonal
Biozol Catalog Number: ABN-H00000653-M51
Supplier Catalog Number: H00000653-M51
Alternative Catalog Number: ABN-H00000653-M51-100
Manufacturer: Abnova
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: BMP5 (AAH27958.1, 323 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Names: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a partial recombinant BMP5.
Clonality: Monoclonal
Clone Designation: [1G6]
UniProt: 653
Buffer: In 1x PBS, pH 7.4
Sequence: NQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPT
Target: BMP5