LTB4R (Human) Recombinant Protein

Catalog Number: ABN-H00001241-G01
Article Name: LTB4R (Human) Recombinant Protein
Biozol Catalog Number: ABN-H00001241-G01
Supplier Catalog Number: H00001241-G01
Alternative Catalog Number: ABN-H00001241-G01-2
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP
Species Reactivity: Human
Human LTB4R full-length ORF (ABW03628.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).
Tag: None
UniProt: 1241
Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Form: Liquid
Sequence: MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAG
Target: LTB4R
Application Dilute: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.