IFNG (Human) Recombinant Protein

Catalog Number: ABN-P10579
Article Name: IFNG (Human) Recombinant Protein
Biozol Catalog Number: ABN-P10579
Supplier Catalog Number: P10579
Alternative Catalog Number: ABN-P10579-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human IFNG partial recombinant protein with His tag expressed in HEK293 cells.
Tag: His (C-term)
UniProt: 3458
Buffer: Lyophilized from filtered PBS, pH 7.4.
Form: Lyophilized
Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Target: IFNG
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.