IL17A (Human) Recombinant Protein, Mammal
Catalog Number:
ABN-P10594
| Article Name: |
IL17A (Human) Recombinant Protein, Mammal |
| Biozol Catalog Number: |
ABN-P10594 |
| Supplier Catalog Number: |
P10594 |
| Alternative Catalog Number: |
ABN-P10594-100 |
| Manufacturer: |
Abnova |
| Host: |
Mammal |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human IL17A partial recombinant protein with His tag expressed in CHO cells. |
| Tag: |
His (N-term) |
| UniProt: |
3605 |
| Buffer: |
Lyophilized from filtered PBS, pH 7.4. |
| Purity: |
>=80% by SDS-PAGE |
| Form: |
Lyophilized |
| Sequence: |
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Target: |
IL17A |
| Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
