GIP (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P10632
Article Name: GIP (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P10632
Supplier Catalog Number: P10632
Alternative Catalog Number: ABN-P10632-100
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human GIP partial recombinant protein with Human IgG1 Fc tag at the C-terminus expressed in CHO cells.
Tag: Fc (C-term)
UniProt: 2695
Buffer: Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Purity: >=95% as determined by SDS-PAGE.
Form: Lyophilized
Sequence: EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Target: GIP
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.