TNFRSF4 (Human) Recombinant Protein, Mammal
Catalog Number:
ABN-P10641
| Article Name: |
TNFRSF4 (Human) Recombinant Protein, Mammal |
| Biozol Catalog Number: |
ABN-P10641 |
| Supplier Catalog Number: |
P10641 |
| Alternative Catalog Number: |
ABN-P10641-100 |
| Manufacturer: |
Abnova |
| Host: |
Mammal |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human TNFRSF4 partial recombinant protein with His tag at the C-terminus expressed in CHO cells. |
| Tag: |
His (C-term) |
| UniProt: |
7293 |
| Buffer: |
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4. |
| Purity: |
>=90% as determined by SDS-PAGE. |
| Form: |
Lyophilized |
| Sequence: |
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAA |
| Target: |
TNFRSF4 |
| Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
