Anti-SUR2A Antibody FL550 Conjugate, IgG2a, Clone: [N319A/14], Mouse, Monoclonal

Catalog Number: ANI-75-296-FL550
Article Name: Anti-SUR2A Antibody FL550 Conjugate, IgG2a, Clone: [N319A/14], Mouse, Monoclonal
Biozol Catalog Number: ANI-75-296-FL550
Supplier Catalog Number: 75-296-FL550
Alternative Catalog Number: ANI-75-296-FL550
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Mouse, Rat
Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
Conjugation: FL550
Alternative Names: ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Our Anti-SUR2A mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N319A/14. It is KO validated, detects mouse and rat SUR2A, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Clonality: Monoclonal
Concentration: 0.5 mg/mL
Clone Designation: [N319A/14]
Molecular Weight: 120 kDa
Isotype: IgG2a
UniProt: P70170
Buffer: PBS with 0.09% azide
Target: SUR2A
Antibody Type: Primary Antibody
Application Notes: Format: Purified by Protein A chromatography