Anti-SUR1 and SUR2B Antibody (BSA and Azide free), IgG1, Clone: [N323A/31], Unconjugated, Mouse, Monoclonal

Catalog Number: ANI-75-298-CF
Article Name: Anti-SUR1 and SUR2B Antibody (BSA and Azide free), IgG1, Clone: [N323A/31], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ANI-75-298-CF
Supplier Catalog Number: 75-298-CF
Alternative Catalog Number: ANI-75-298-CF
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ELISA, ICC, IHC, WB
Species Reactivity: Mouse, Rat
Immunogen: Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
Conjugation: Unconjugated
Alternative Names: ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Our carrier-free Anti-SUR1 and SUR2B mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N323A/31. It detects mouse and rat SUR1 and SUR2B, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
Clonality: Monoclonal
Concentration: 1 mg/mL
Clone Designation: [N323A/31]
Molecular Weight: 175 kDa (and smaller fragments likely due to proteolytic cleavage)
Isotype: IgG1
UniProt: Q63563
Buffer: PBS
Target: SUR1 and SUR2B
Antibody Type: Primary Antibody
Application Notes: Format: Purified by Protein A chromatography