Anti-REEP1 Antibody (BSA and Azide free), IgG2b, Clone: [N345/51], Unconjugated, Mouse, Monoclonal

Catalog Number: ANI-75-313-CF
Article Name: Anti-REEP1 Antibody (BSA and Azide free), IgG2b, Clone: [N345/51], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ANI-75-313-CF
Supplier Catalog Number: 75-313-CF
Alternative Catalog Number: ANI-75-313-CF
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ELISA, ICC, IHC, WB
Species Reactivity: Mouse, Rat
Immunogen: Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
Conjugation: Unconjugated
Alternative Names: Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
Our carrier-free Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
Clonality: Monoclonal
Concentration: 1 mg/mL
Clone Designation: [N345/51]
Molecular Weight: 22 kDa
Isotype: IgG2b
UniProt: Q8BGH4
Buffer: PBS
Target: REEP1
Antibody Type: Primary Antibody
Application Notes: Format: Purified by Protein A chromatography