PHLPP2 Antibody : HRP (ARP42429_P050-HRP), Rabbit, Polyclonal
Catalog Number:
ASB-ARP42429_P050-HRP
- Images (0)
| Article Name: | PHLPP2 Antibody : HRP (ARP42429_P050-HRP), Rabbit, Polyclonal |
| Biozol Catalog Number: | ASB-ARP42429_P050-HRP |
| Supplier Catalog Number: | ARP42429_P050-HRP |
| Alternative Catalog Number: | ASB-ARP42429_P050-HRP-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Antikörper |
| Species Reactivity: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence ASSFSLTVANVGTCQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAII |
| Conjugation: | HRP |
| Alternative Names: | PPM3B, PHLPPL |
