AICDA Antibody : FITC (ARP63254_P050-FITC), Rabbit, Polyclonal

Catalog Number: ASB-ARP63254_P050-FITC
Article Name: AICDA Antibody : FITC (ARP63254_P050-FITC), Rabbit, Polyclonal
Biozol Catalog Number: ASB-ARP63254_P050-FITC
Supplier Catalog Number: ARP63254_P050-FITC
Alternative Catalog Number: ASB-ARP63254_P050-FITC-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
Conjugation: FITC
Alternative Names: AID, ARP2, CDA2, HIGM2, HEL-S-284
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 24 kDa
NCBI: 57379
UniProt: Q9GZX7
Form: Liquid. Purified antibody supplied in 1x PBS buffer.