RAC1 Protein, E. coli

Catalog Number: ASB-OPPA01446
Article Name: RAC1 Protein, E. coli
Biozol Catalog Number: ASB-OPPA01446
Supplier Catalog Number: OPPA01446
Alternative Catalog Number: ASB-OPPA01446-10UG
Manufacturer: Aviva
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: MIG5, MRD48, Rac-1, TC-25, p21-Rac1
RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion. RAC1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids.
Concentration: 1 mg/ml
Molecular Weight: 21 kDa
NCBI: 5879
Purity: Greater than 95.0% as determined by SDS-PAGE.
Form: Liquid 20mM Tris-HCl (pH 7.5), 2mM EDTA & 1mM DTTPhysical Appearance: Sterile filtered colorless solution
Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.