Anti-CENPV
Catalog Number:
ATA-HPA042616
- Images (9)
| Article Name: | Anti-CENPV |
| Biozol Catalog Number: | ATA-HPA042616 |
| Supplier Catalog Number: | HPA042616 |
| Alternative Catalog Number: | ATA-HPA042616-100,ATA-HPA042616-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CENP-V, p30, PRR6 |
| centromere protein V |
| Anti-CENPV |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 201161 |
| UniProt: | Q7Z7K6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CENPV |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and skin tissues using HPA042616 antibody. Corresponding CENPV RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human gastrointestinal shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells as expected. |
|
|
Western blot analysis in human cell line HEK 293. |
|
|
HPA042616-100ul |
|
|
HPA042616-100ul |
|
|
HPA042616-100ul |
Product Guarantee and Expert Support
