Anti-NUDT16L1
Catalog Number:
ATA-HPA044186
- Images (9)
| Article Name: | Anti-NUDT16L1 |
| Biozol Catalog Number: | ATA-HPA044186 |
| Supplier Catalog Number: | HPA044186 |
| Alternative Catalog Number: | ATA-HPA044186-100,ATA-HPA044186-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SDOS |
| nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 |
| Anti-NUDT16L1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 84309 |
| UniProt: | Q9BRJ7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NUDT16L1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes. |
|
|
|
|
|
HPA044186-100ul |
|
|
HPA044186-100ul |
|
|
HPA044186-100ul |
Product Guarantee and Expert Support
