Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20550
Article Name: Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20550
Supplier Catalog Number: RPC20550
Alternative Catalog Number: BIM-RPC20550-20UG,BIM-RPC20550-100UG,BIM-RPC20550-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Jumonji domain-containing protein 1CThyroid receptor-interacting protein 8
Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: JMJD1C. Target Synonyms: Jumonji domain-containing protein 1CThyroid receptor-interacting protein 8. Accession Number: Q15652. Expression Region: 2274~2498aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 45.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 45.5kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Target: JMJD1C