Recombinant E. coli K99 fimbrial protein (fanC), Unconjugated

Catalog Number: BIM-RPC20557
Article Name: Recombinant E. coli K99 fimbrial protein (fanC), Unconjugated
Biozol Catalog Number: BIM-RPC20557
Supplier Catalog Number: RPC20557
Alternative Catalog Number: BIM-RPC20557-20UG,BIM-RPC20557-100UG,BIM-RPC20557-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: fanCK99 fimbrial protein
Recombinant E. coli K99 fimbrial protein (fanC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: fanC. Target Synonyms: fanCK99 fimbrial protein. Accession Number: P18103. Expression Region: 23~181aa. Tag Info: Tag-Free. Theoretical MW: 16.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.5kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Target: fanC