Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial, Unconjugated, Mammal

Catalog Number: BIM-RPC20583
Article Name: Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC20583
Supplier Catalog Number: RPC20583
Alternative Catalog Number: BIM-RPC20583-20UG,BIM-RPC20583-100UG,BIM-RPC20583-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Accession Number: P55899. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 24~297aa. Protein Length: Extracellular Domain. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial is a purified Recombinant Protein
Molecular Weight: 34.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIV
Target: FCGRT