Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G), Unconjugated, Mammal

Catalog Number: BIM-RPC20584
Article Name: Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G), Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC20584
Supplier Catalog Number: RPC20584
Alternative Catalog Number: BIM-RPC20584-20UG,BIM-RPC20584-100UG,BIM-RPC20584-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: HLA G antigen, MHC class I antigen G
Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HLA-G. Target Synonyms: HLA G antigen, MHC class I antigen G. Accession Number: P17693. Expression Region: 25~338aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 39.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQ
Target: HLA-G