Recombinant Pig Heat shock protein HSP 90-alpha (HSP90AA1), partial, Unconjugated, Virus

Catalog Number: BIM-RPC20596
Article Name: Recombinant Pig Heat shock protein HSP 90-alpha (HSP90AA1), partial, Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20596
Supplier Catalog Number: RPC20596
Alternative Catalog Number: BIM-RPC20596-20UG,BIM-RPC20596-100UG,BIM-RPC20596-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Porcine
Conjugation: Unconjugated
Alternative Names: HSP90AA1, HSP90A, HSPCAHeat shock protein HSP 90-alpha
Recombinant Pig Heat shock protein HSP 90-alpha (HSP90AA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: HSP90AA1. Target Synonyms: HSP90AA1, HSP90A, HSPCAHeat shock protein HSP 90-alpha. Accession Number: O02705. Expression Region: 222~367aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR
Target: HSP90AA1