Recombinant Salmonella enterica OmpA family protein (A673_03341), partial, Unconjugated, Mammal

Catalog Number: BIM-RPC20600
Article Name: Recombinant Salmonella enterica OmpA family protein (A673_03341), partial, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC20600
Supplier Catalog Number: RPC20600
Alternative Catalog Number: BIM-RPC20600-20UG,BIM-RPC20600-100UG,BIM-RPC20600-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Recombinant Salmonella enterica OmpA family protein (A673_03341), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958. Target Name: A673_03341. Accession Number: S4JJH7. Expression Region: 82~220aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 18.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
Target: A673_03341