Recombinant Human Lupus La protein (SSB), Unconjugated, Virus

Catalog Number: BIM-RPC20659
Article Name: Recombinant Human Lupus La protein (SSB), Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20659
Supplier Catalog Number: RPC20659
Alternative Catalog Number: BIM-RPC20659-20UG,BIM-RPC20659-100UG,BIM-RPC20659-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: La autoantigenLa ribonucleoproteinSjoegren syndrome type B antigenSS-B
Recombinant Human Lupus La protein (SSB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SSB. Target Synonyms: La autoantigenLa ribonucleoproteinSjoegren syndrome type B antigenSS-B. Accession Number: P05455. Expression Region: 1~408aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 50.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 50.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSN
Target: SSB