Recombinant Hepatitis delta virus genotype I Large delta antigen, Unconjugated, Virus

Catalog Number: BIM-RPC20668
Article Name: Recombinant Hepatitis delta virus genotype I Large delta antigen, Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20668
Supplier Catalog Number: RPC20668
Alternative Catalog Number: BIM-RPC20668-20UG,BIM-RPC20668-100UG,BIM-RPC20668-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: p27
Recombinant Hepatitis delta virus genotype I Large delta antigen is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Hepatitis delta virus genotype I (isolate Italian) (HDV). Target Name: Hepatitis delta virus genotype I Large delta antigen. Target Synonyms: p27. Accession Number: P0C6L6. Expression Region: 1~211aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC
Target: Hepatitis delta virus genotype I Large delta antigen