Recombinant Aspergillus niger Glucose oxidase (gox), partial, Unconjugated, Virus

Catalog Number: BIM-RPC20670
Article Name: Recombinant Aspergillus niger Glucose oxidase (gox), partial, Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20670
Supplier Catalog Number: RPC20670
Alternative Catalog Number: BIM-RPC20670-20UG,BIM-RPC20670-100UG,BIM-RPC20670-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: Beta-D-glucose:oxygen 1-oxido-reductaseGlucose oxyhydrase
Recombinant Aspergillus niger Glucose oxidase (gox), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Aspergillus niger. Target Name: gox. Target Synonyms: Beta-D-glucose:oxygen 1-oxido-reductaseGlucose oxyhydrase. Accession Number: P13006. Expression Region: 23~604aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 65.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 65.6kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SNGIEASLLTDPKDVSGRTVDYIIAGGGLTGLTTAARLTENPNISVLVIESGSYESDRGPIIEDLNAYGDIFGSSVDHAYETVELATNNQTALIRSGNGLGGSTLVNGGTWTRPHKAQVDSWETVFGNEGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGTVHAGPRDTGDDYSPIVKALMSAVEDRGVPTKKDFGCGDPHGVSMFPNTLHEDQVRSDAAREWLLPNYQRPNLQVLTGQYVGKVLL
Target: gox