Recombinant E. coli Acidic protein msyB (msyB), Unconjugated, Virus

Catalog Number: BIM-RPC20673
Article Name: Recombinant E. coli Acidic protein msyB (msyB), Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20673
Supplier Catalog Number: RPC20673
Alternative Catalog Number: BIM-RPC20673-20UG,BIM-RPC20673-100UG,BIM-RPC20673-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: msyB, b1051, JW1039, Acidic protein MsyB
Recombinant E. coli Acidic protein msyB (msyB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: msyB. Target Synonyms: msyB, b1051, JW1039, Acidic protein MsyB. Accession Number: P25738. Expression Region: 1~124aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 16.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.3kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Target: msyB