Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1), Unconjugated, Virus

Catalog Number: BIM-RPC20683
Article Name: Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1), Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20683
Supplier Catalog Number: RPC20683
Alternative Catalog Number: BIM-RPC20683-20UG,BIM-RPC20683-100UG,BIM-RPC20683-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Bee
Conjugation: Unconjugated
Alternative Names: 56- kDa protein 4
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Apis mellifera (Honeybee). Target Name: MRJP1. Target Synonyms: 56- kDa protein 4. Accession Number: O18330. Expression Region: 20~432aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 49.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.4kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTS
Target: MRJP1