Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial, Unconjugated, Virus

Catalog Number: BIM-RPC20702
Article Name: Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial, Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20702
Supplier Catalog Number: RPC20702
Alternative Catalog Number: BIM-RPC20702-20UG,BIM-RPC20702-100UG,BIM-RPC20702-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: p21-activated kinase 5PAK-5p21-activated kinase 7PAK-7
Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PAK5. Target Synonyms: p21-activated kinase 5PAK-5p21-activated kinase 7PAK-7. Accession Number: Q8TB93. Expression Region: 1~293aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 34.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSES
Target: PAK5