Recombinant Human C-C chemokine receptor type 4 (CCR4), Active Protein, Unconjugated

Catalog Number: BIM-RPC20710
Article Name: Recombinant Human C-C chemokine receptor type 4 (CCR4), Active Protein, Unconjugated
Biozol Catalog Number: BIM-RPC20710
Supplier Catalog Number: RPC20710
Alternative Catalog Number: BIM-RPC20710-20UG,BIM-RPC20710-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: K5-5CD_antigen: CD194
Recombinant Human C-C chemokine receptor type 4 (CCR4), Active Protein is a purified CF Transmembrane Protein, Active Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CCR4. Target Synonyms: K5-5CD_antigen: CD194. Accession Number: P51679. Expression Region: 1~360aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 44.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.9kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFW
Target: CCR4