Recombinant Mouse Protein Dihydroorotate dehydrogenase (quinone), mitochondrial (Dhodh), Unconjugated

Catalog Number: BIM-RPC20727
Article Name: Recombinant Mouse Protein Dihydroorotate dehydrogenase (quinone), mitochondrial (Dhodh), Unconjugated
Biozol Catalog Number: BIM-RPC20727
Supplier Catalog Number: RPC20727
Alternative Catalog Number: BIM-RPC20727-20UG,BIM-RPC20727-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Dihydroorotate oxidase
Recombinant Mouse Protein Dihydroorotate dehydrogenase (quinone), mitochondrial (Dhodh) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Dhodh. Target Synonyms: Dihydroorotate oxidase. Accession Number: O35435. Expression Region: 11~395aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 44.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.2kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: LDAAIILGGGGLLFTSYLTATGDDHFYAEYLMPALQRLLDPESAHRLAVRVISLGLLPRATFQDSNMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSAVEHRLRARQQKQTQLTTDGLPLGINLGKNKTSVDAAADYVEGVRILGPLADYLVVNVSSPNTAGLRSLQGKTELRRLLSKVLQERDALKGPQKPAVLVKIAPDLTAQDKE
Target: Dhodh