Recombinant Human Bone marrow proteoglycan (PRG2), partial, Unconjugated

Catalog Number: BIM-RPC20747
Article Name: Recombinant Human Bone marrow proteoglycan (PRG2), partial, Unconjugated
Biozol Catalog Number: BIM-RPC20747
Supplier Catalog Number: RPC20747
Alternative Catalog Number: BIM-RPC20747-20UG,BIM-RPC20747-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Proteoglycan 2Cleaved into the following chain:Eosinophil granule major basic proteinEMBPMBPPregnancy-associated major basic protein
Recombinant Human Bone marrow proteoglycan (PRG2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PRG2. Target Synonyms: Proteoglycan 2Cleaved into the following chain:Eosinophil granule major basic proteinEMBPMBPPregnancy-associated major basic protein. Accession Number: P13727. Expression Region: 106~222aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 29.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Target: PRG2