Recombinant Human Aldo-keto reductase family 1 member C2 (AKR1C2), Unconjugated, E. coli

Catalog Number: BIM-RPC20883
Article Name: Recombinant Human Aldo-keto reductase family 1 member C2 (AKR1C2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20883
Supplier Catalog Number: RPC20883
Alternative Catalog Number: BIM-RPC20883-20UG,BIM-RPC20883-100UG,BIM-RPC20883-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 3-alpha-HSD, 3Chlordecone reductase homolog HAKRD, Dihydrodiol dehydrogenase 2, DD-2, DD2Dihydrodiol dehydrogenase/bile acid-binding protein, DD/BABPTrans-1,2-dihydrobenzene-1,2-diol dehydrogenase (EC:1.3.1.20), Type III 3-alpha-hydroxysteroid dehydrogenase (EC:1.1.1.357)
Recombinant Human Aldo-keto reductase family 1 member C2 (AKR1C2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: AKR1C2. Target Synonyms: 3-alpha-HSD, 3Chlordecone reductase homolog HAKRD, Dihydrodiol dehydrogenase 2, DD-2, DD2Dihydrodiol dehydrogenase/bile acid-binding protein, DD/BABPTrans-1,2-dihydrobenzene-1,2-diol dehydrogenase (EC:1.3.1.20). Accession Number: P52895. Expression Region: 1~323aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 52.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 52.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALI
Target: AKR1C2