Recombinant Mouse Muellerian-inhibiting factor (Amh), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20896
Article Name: Recombinant Mouse Muellerian-inhibiting factor (Amh), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20896
Supplier Catalog Number: RPC20896
Alternative Catalog Number: BIM-RPC20896-20UG,BIM-RPC20896-100UG,BIM-RPC20896-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Anti-Muellerian hormone
Recombinant Mouse Muellerian-inhibiting factor (Amh), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Amh. Target Synonyms: Anti-Muellerian hormone. Accession Number: P27106. Expression Region: 450~552aa. Tag Info: Tag-Free. Theoretical MW: 11.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 11.3kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Target: Amh