Recombinant Rabbit Apolipoprotein E (APOE), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20920
Article Name: Recombinant Rabbit Apolipoprotein E (APOE), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20920
Supplier Catalog Number: RPC20920
Alternative Catalog Number: BIM-RPC20920-20UG,BIM-RPC20920-100UG,BIM-RPC20920-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rabbit
Conjugation: Unconjugated
Alternative Names: APOEApolipoprotein E, Apo-E
Recombinant Rabbit Apolipoprotein E (APOE), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus). Target Name: APOE. Target Synonyms: APOEApolipoprotein E, Apo-E. Accession Number: P18287. Expression Region: 20~311aa. Tag Info: N-Terminal 10Xhis-B2M-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 50.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 50.6kDa
Tag: N-Terminal 10Xhis-B2M-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKS
Target: APOE