Recombinant Human ADP-ribosylation factor 1 (ARF1), Unconjugated, E. coli

Catalog Number: BIM-RPC20925
Article Name: Recombinant Human ADP-ribosylation factor 1 (ARF1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20925
Supplier Catalog Number: RPC20925
Alternative Catalog Number: BIM-RPC20925-20UG,BIM-RPC20925-100UG,BIM-RPC20925-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ADP Ribosylation Factor 1, ADP-ribosylation factor 1, ARF 1, ARF1, ARF1_HUMAN
Recombinant Human ADP-ribosylation factor 1 (ARF1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ARF1. Target Synonyms: ADP Ribosylation Factor 1, ADP-ribosylation factor 1, ARF 1, ARF1, ARF1_HUMAN. Accession Number: P84077. Expression Region: 2~181aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 55.7kDa
Tag: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Target: ARF1