Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20954
Article Name: Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20954
Supplier Catalog Number: RPC20954
Alternative Catalog Number: BIM-RPC20954-20UG,BIM-RPC20954-100UG,BIM-RPC20954-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Gastric H(+)/K(+) ATPase subunit betaProton pump beta chain
Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP4B. Target Synonyms: Gastric H(+)/K(+) ATPase subunit betaProton pump beta chain. Accession Number: P51164. Expression Region: 58~291aa. Tag Info: Tag-Free. Theoretical MW: 26.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.6kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Target: ATP4B