Recombinant Mouse Baculoviral IAP repeat-containing protein 5 (Birc5), Unconjugated, E. coli

Catalog Number: BIM-RPC20980
Article Name: Recombinant Mouse Baculoviral IAP repeat-containing protein 5 (Birc5), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20980
Supplier Catalog Number: RPC20980
Alternative Catalog Number: BIM-RPC20980-20UG,BIM-RPC20980-100UG,BIM-RPC20980-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Apoptosis inhibitor 4, Apoptosis inhibitor survivin, TIAP
Recombinant Mouse Baculoviral IAP repeat-containing protein 5 (Birc5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Birc5. Target Synonyms: Apoptosis inhibitor 4, Apoptosis inhibitor survivin, TIAP. Accession Number: O70201. Expression Region: 1~140aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA
Target: Birc5