Recombinant Human Complement C1q subcomponent subunit A (C1QA), Unconjugated, E. coli

Catalog Number: BIM-RPC20997
Article Name: Recombinant Human Complement C1q subcomponent subunit A (C1QA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20997
Supplier Catalog Number: RPC20997
Alternative Catalog Number: BIM-RPC20997-20UG,BIM-RPC20997-100UG,BIM-RPC20997-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: C1qa, C1QA_HUMAN, Complement C1q subcomponent subunit A, Complement component 1 q subcomponent A chain, Complement component 1 q subcomponent alpha polypeptide, Complement component C1q A chain
Recombinant Human Complement C1q subcomponent subunit A (C1QA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: C1QA. Target Synonyms: C1qa, C1QA_HUMAN, Complement C1q subcomponent subunit A, Complement component 1 q subcomponent A chain, Complement component 1 q subcomponent alpha polypeptide, Complement component C1q A chain. Accession Number: P02745. Expression Region: 23~245aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 30.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Target: C1QA