Recombinant Human Carbonic anhydrase 2 (CA2), Unconjugated, E. coli

Catalog Number: BIM-RPC21006
Article Name: Recombinant Human Carbonic anhydrase 2 (CA2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21006
Supplier Catalog Number: RPC21006
Alternative Catalog Number: BIM-RPC21006-20UG,BIM-RPC21006-100UG,BIM-RPC21006-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Carbonate dehydratase II, Carbonic anhydrase C, CAC, Carbonic anhydrase II, CA-II
Recombinant Human Carbonic anhydrase 2 (CA2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CA2. Target Synonyms: Carbonate dehydratase II, Carbonic anhydrase C, CAC, Carbonic anhydrase II, CA-II. Accession Number: P00918. Expression Region: 2~260aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 45.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 45.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIK
Target: CA2