Recombinant Human Calreticulin (CALR), Unconjugated, E. coli

Catalog Number: BIM-RPC21017
Article Name: Recombinant Human Calreticulin (CALR), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21017
Supplier Catalog Number: RPC21017
Alternative Catalog Number: BIM-RPC21017-20UG,BIM-RPC21017-100UG,BIM-RPC21017-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: CRP55CalregulinEndoplasmic reticulum resident protein 60HACBPgrp60CRTC
Recombinant Human Calreticulin (CALR) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CALR. Target Synonyms: CRP55CalregulinEndoplasmic reticulum resident protein 60HACBPgrp60CRTC. Accession Number: P27797. Expression Region: 18~417aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 73.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 73.5kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYK
Target: CALR