Recombinant Human Calpain-1 catalytic subunit (CAPN1), Unconjugated, E. coli

Catalog Number: BIM-RPC21023
Article Name: Recombinant Human Calpain-1 catalytic subunit (CAPN1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21023
Supplier Catalog Number: RPC21023
Alternative Catalog Number: BIM-RPC21023-20UG,BIM-RPC21023-100UG,BIM-RPC21023-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Calcium-activated neutral proteinase 1, CANP 1Calpain mu-typeCalpain-1 large subunit, Cell proliferation-inducing gene 30 protein, Micromolar-calpain, muCANP
Recombinant Human Calpain-1 catalytic subunit (CAPN1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CAPN1. Target Synonyms: Calcium-activated neutral proteinase 1, CANP 1Calpain mu-typeCalpain-1 large subunit, Cell proliferation-inducing gene 30 protein, Micromolar-calpain, muCANP. Accession Number: P07384. Expression Region: 1~714aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 85.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 85.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDIS
Target: CAPN1