Recombinant Rabbit CD40 ligand (CD40LG), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21056
Article Name: Recombinant Rabbit CD40 ligand (CD40LG), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21056
Supplier Catalog Number: RPC21056
Alternative Catalog Number: BIM-RPC21056-20UG,BIM-RPC21056-100UG,BIM-RPC21056-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rabbit
Conjugation: Unconjugated
Alternative Names: Tumor necrosis factor ligand superfamily member 5
Recombinant Rabbit CD40 ligand (CD40LG), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus). Target Name: CD40LG. Target Synonyms: Tumor necrosis factor ligand superfamily member 5. Accession Number: G1SKP7. Expression Region: 113~261aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 20.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL
Target: CD40LG