Recombinant Human Claudin-3 (CLDN3), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21102
Article Name: Recombinant Human Claudin-3 (CLDN3), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21102
Supplier Catalog Number: RPC21102
Alternative Catalog Number: BIM-RPC21102-20UG,BIM-RPC21102-100UG,BIM-RPC21102-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Clostridium perfringens enterotoxin receptor 2
Recombinant Human Claudin-3 (CLDN3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CLDN3. Target Synonyms: Clostridium perfringens enterotoxin receptor 2. Accession Number: O15551. Expression Region: 30~80aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 19.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.7kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Target: CLDN3