Recombinant Mouse Chymase (Cma1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21113
Article Name: Recombinant Mouse Chymase (Cma1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21113
Supplier Catalog Number: RPC21113
Alternative Catalog Number: BIM-RPC21113-20UG,BIM-RPC21113-100UG,BIM-RPC21113-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Alpha-chymase, Mast cell chymase 1Mast cell protease 5, mMCP-5Mast cell protease I
Recombinant Mouse Chymase (Cma1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Cma1. Target Synonyms: Alpha-chymase, Mast cell chymase 1Mast cell protease 5, mMCP-5Mast cell protease I. Accession Number: P21844. Expression Region: 22~246aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE
Target: Cma1