Recombinant Human Alpha-crystallin B chain (CRYAB), Unconjugated, E. coli

Catalog Number: BIM-RPC21139
Article Name: Recombinant Human Alpha-crystallin B chain (CRYAB), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21139
Supplier Catalog Number: RPC21139
Alternative Catalog Number: BIM-RPC21139-20UG,BIM-RPC21139-100UG,BIM-RPC21139-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Alpha(B)-crystallinHeat shock protein beta-5, HspB5Renal carcinoma antigen NY-REN-27Rosenthal fiber component
Recombinant Human Alpha-crystallin B chain (CRYAB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CRYAB. Target Synonyms: Alpha(B)-crystallinHeat shock protein beta-5, HspB5Renal carcinoma antigen NY-REN-27Rosenthal fiber component. Accession Number: P02511. Expression Region: 1~175aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 36.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Target: CRYAB