Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21211
Article Name: Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21211
Supplier Catalog Number: RPC21211
Alternative Catalog Number: BIM-RPC21211-20UG,BIM-RPC21211-100UG,BIM-RPC21211-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Dihydroorotate oxidase
Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DHODH. Target Synonyms: Dihydroorotate oxidase. Accession Number: Q02127. Expression Region: 31~395aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 45.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 45.1kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTT
Target: DHODH