Recombinant Rat Dipeptidyl peptidase 4 (Dpp4), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21222
Article Name: Recombinant Rat Dipeptidyl peptidase 4 (Dpp4), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21222
Supplier Catalog Number: RPC21222
Alternative Catalog Number: BIM-RPC21222-20UG,BIM-RPC21222-100UG,BIM-RPC21222-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Bile canaliculus domain-specific membrane glycoproteinDipeptidyl peptidase IVDPP IVGP110 glycoproteinT-cell activation antigen CD26CD_antigen: CD26Cleaved into the following 3 chains:Dipeptidyl peptidase 4 membrane formDipeptidyl peptidase IV membrane formDipeptidyl peptidase 4 soluble formDipeptidyl peptidase IV soluble formDipeptidyl peptidase 4 60 kDa soluble formDipeptidyl peptidase IV 60 kDa soluble form
Recombinant Rat Dipeptidyl peptidase 4 (Dpp4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Dpp4. Target Synonyms: Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IVDPP IVGP110 glycoproteinT-cell activation antigen CD26CD_antigen: CD26 Cleaved into the following 3 chains:Dipeptidyl peptidase 4 membrane form. Accession Number: P14740. Expression Region: 638~767aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Target: Dpp4