Recombinant Human Chymotrypsin-like elastase family member 3A (CELA3A), Unconjugated, E. coli

Catalog Number: BIM-RPC21258
Article Name: Recombinant Human Chymotrypsin-like elastase family member 3A (CELA3A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21258
Supplier Catalog Number: RPC21258
Alternative Catalog Number: BIM-RPC21258-20UG,BIM-RPC21258-100UG,BIM-RPC21258-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Elastase IIIA, Elastase-3A, Protease E
Recombinant Human Chymotrypsin-like elastase family member 3A (CELA3A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CELA3A. Target Synonyms: Elastase IIIA, Elastase-3A, Protease E. Accession Number: P09093. Expression Region: 29~270aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
Target: CELA3A