Recombinant Macaca fascicularis Erythropoietin (EPO), Unconjugated, E. coli

Catalog Number: BIM-RPC21272
Article Name: Recombinant Macaca fascicularis Erythropoietin (EPO), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21272
Supplier Catalog Number: RPC21272
Alternative Catalog Number: BIM-RPC21272-20UG,BIM-RPC21272-100UG,BIM-RPC21272-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: EPOErythropoietin
Recombinant Macaca fascicularis Erythropoietin (EPO) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Target Name: EPO. Target Synonyms: EPOErythropoietin. Accession Number: P07865. Expression Region: 28~192aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Target: EPO