Recombinant Human Coagulation factor XI (F11), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21289
Article Name: Recombinant Human Coagulation factor XI (F11), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21289
Supplier Catalog Number: RPC21289
Alternative Catalog Number: BIM-RPC21289-20UG,BIM-RPC21289-100UG,BIM-RPC21289-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Plasma thromboplastin antecedentPTACleaved into the following 2 chains:Coagulation factor XIa heavy chainCoagulation factor XIa light chain
Recombinant Human Coagulation factor XI (F11), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: F11. Target Synonyms: Plasma thromboplastin antecedentPTACleaved into the following 2 chains:Coagulation factor XIa heavy chainCoagulation factor XIa light chain. Accession Number: P03951. Expression Region: 19~387aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 45.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 45.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSK
Target: F11