Recombinant Mouse fMet-Leu-Phe receptor (Fpr1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Fpr1. Target Synonyms: N-formyl peptide receptorFPRN-formylpeptide chemoattractant receptor. Accession Number: P33766. Expression Region: 1~35aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight:
33.7kDa
Tag:
N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity:
>85% by SDS-PAGE
Sequence:
MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV
Target:
Fpr1
* VAT and and shipping costs not included. Errors and price changes excepted
